SNRK anticorps (Middle Region)

N° du produit ABIN631138

Cet anticorps Lapin Polyclonal détecte spécifiquement SNRK dans WB. Il présente une réactivité envers Humain et Rat.

Aperçu rapide pour SNRK anticorps (Middle Region) (ABIN631138)

Antigène: SNRK (SNF Related Kinase (SNRK))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SNRK est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SNRK anticorps

Épitope: Middle Region

Specificité: SNRK antibody was raised against the middle region of SNRK

Purification: Affinity purified

Immunogène: SNRK antibody was raised using the middle region of SNRK corresponding to a region with amino acids SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SNRK Blocking Peptide, (ABIN5616319), is also available for use as a blocking control in assays to test for specificity of this SNRK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNRK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SNRK

Antigène: SNRK (SNF Related Kinase (SNRK))

Autre désignation: SNRK

Sujet: SNRK may play a role in hematopoietic cell proliferation or differentiation. SNRK is the potential mediator of neuronal apoptosis.

Poids moléculaire: 84 kDa (MW of target protein)